Structure of PDB 2a8v Chain A Binding Site BS01

Receptor Information
>2a8v Chain A (length=118) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIF
GDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGK
IRPPKEGERYFALLKVNE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2a8v The structural basis for terminator recognition by the Rho transcription termination factor.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
F62 F64 R66 A74 Y80 E108 R109 Y110
Binding residue
(residue number reindexed from 1)
F62 F64 R66 A74 Y80 E108 R109 Y110
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005524 ATP binding
GO:0008186 ATP-dependent activity, acting on RNA
Biological Process
GO:0006353 DNA-templated transcription termination

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:2a8v, PDBe:2a8v, PDBj:2a8v
PDBsum2a8v
PubMed10230401
UniProtP0AG30|RHO_ECOLI Transcription termination factor Rho (Gene Name=rho)

[Back to BioLiP]