Structure of PDB 2a66 Chain A Binding Site BS01

Receptor Information
>2a66 Chain A (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKT
QRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRAL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2a66 Crystal Structure of the Human LRH-1 DBD-DNA Complex Reveals Ftz-F1 Domain Positioning is Required for Receptor Activity.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Y96 H97 Y98 K107 K111 V156 R157 M161 R162 R165 N166 Y172
Binding residue
(residue number reindexed from 1)		Y13 H14 Y15 K24 K28 V73 R74 M78 R79 R82 N83 Y89
Binding affinityPDBbind-CN: Kd=122nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0004879 nuclear receptor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2a66, PDBe:2a66, PDBj:2a66
PDBsum2a66
PubMed16289203
UniProtO00482|NR5A2_HUMAN Nuclear receptor subfamily 5 group A member 2 (Gene Name=NR5A2)

[Back to BioLiP]