Structure of PDB 2a4j Chain A Binding Site BS01

Receptor Information
>2a4j Chain A (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQ
EMIDEADRDGDGEVSEQEFLRIMKKTSLY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2a4j Flexibility and plasticity of human centrin 2 binding to the xeroderma pigmentosum group C protein (XPC) from nuclear excision repair.
ResolutionN/A
Binding residue
(original residue number in PDB)		E105 K108 A109 L126 V129 A130 E135 L137 M145 E161 F162 I165 M166 S170
Binding residue
(residue number reindexed from 1)		E12 K15 A16 L33 V36 A37 E42 L44 M52 E68 F69 I72 M73 S77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:2a4j, PDBe:2a4j, PDBj:2a4j
PDBsum2a4j
PubMed16533048
UniProtP41208|CETN2_HUMAN Centrin-2 (Gene Name=CETN2)

[Back to BioLiP]