Structure of PDB 1zzj Chain A Binding Site BS01

Receptor Information
>1zzj Chain A (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSED
RIITITGTQDQIQNAQYLLQNSVKQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zzj X-Ray Crystallographic and NMR Studies of the Third KH Domain of hnRNP K in Complex with Single-Stranded Nucleic Acids
Resolution2.3 Å
Binding residue
(original residue number in PDB)		G26 I29 G30 K31 G32 G33 R40 H41 R59
Binding residue
(residue number reindexed from 1)		G18 I21 G22 K23 G24 G25 R32 H33 R51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:1zzj, PDBe:1zzj, PDBj:1zzj
PDBsum1zzj
PubMed16004877
UniProtP61978|HNRPK_HUMAN Heterogeneous nuclear ribonucleoprotein K (Gene Name=HNRNPK)

[Back to BioLiP]