Structure of PDB 1zzi Chain A Binding Site BS01

Receptor Information

>1zzi Chain A (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GAMGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSE
DRIITITGTQDQIQNAQYLLQNSVKQYSGKFF

Ligand information

>1zzi Chain C (length=6) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ctcccc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1zzi X-Ray Crystallographic and NMR Studies of the Third KH Domain of hnRNP K in Complex with Single-Stranded Nucleic Acids
Resolution	1.8 Å
Binding residue (original residue number in PDB)	G26 S27 I29 G30 K31 G32 G33 R40 E51 R59 Y84 S85
Binding residue (residue number reindexed from 1)	G19 S20 I22 G23 K24 G25 G26 R33 E44 R52 Y77 S78
Binding affinity	PDBbind-CN: Kd=2.2uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:1zzi, PDBe:1zzi, PDBj:1zzi
PDBsum	1zzi
PubMed	16004877
UniProt	P61978\|HNRPK_HUMAN Heterogeneous nuclear ribonucleoprotein K (Gene Name=HNRNPK)

[Back to BioLiP]