Structure of PDB 1zy3 Chain A Binding Site BS01

Receptor Information
>1zy3 Chain A (length=170) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGD
EFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFV
FGAALCAESVNKEMEVLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALY
GDGALEEARRLREGNWASVR
Ligand information
>1zy3 Chain B (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IIKNIARHLAQVGDSMDRSI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zy3 Structural Model of the BCL-w-BID Peptide Complex and Its Interactions with Phospholipid Micelles.
ResolutionN/A
Binding residue
(original residue number in PDB)		F52 R55 F56 Q66 L67 T70 R77 V81 E84 L85 N91 W92 G93 R94 D152 G153 E156 R159 L161
Binding residue
(residue number reindexed from 1)		F52 R55 F56 Q66 L67 T70 R77 V81 E84 L85 N91 W92 G93 R94 D152 G153 E156 R159 L161
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:1zy3, PDBe:1zy3, PDBj:1zy3
PDBsum1zy3
PubMed16475813
UniProtQ92843|B2CL2_HUMAN Bcl-2-like protein 2 (Gene Name=BCL2L2)

[Back to BioLiP]