Structure of PDB 1zy1 Chain A Binding Site BS01

Receptor Information
>1zy1 Chain A (length=191) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLPEIVASGDPVLHEKAREVDPGEIGSERIQKIIDDMIKVMRLAPGVGLA
APQIGVPLRIIVLEDTKEYISYAPKEEILAQERRHFDLMVMVNPVLKERS
NKKALFFEGCLSVDGFRAAVERYLEVVVTGYDRQGKRIEVNASGWQARIL
QHECDHLDGNLYVDKMVPRTFRTVDNLDLPLAEGCPKLGSH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zy1 The crystal structure of mitochondrial (Type 1A) peptide deformylase provides clear guidelines for the design of inhibitors specific for the bacterial forms
Resolution3.0 Å
Binding residue
(original residue number in PDB)		P46 G47 V48 G49 E109 G110 R149 H153 E154
Binding residue
(residue number reindexed from 1)		P45 G46 V47 G48 E108 G109 R148 H152 E153
Enzymatic activity
Catalytic site (original residue number in PDB) G49 Q54 C111 L112 H153 E154 H157
Catalytic site (residue number reindexed from 1) G48 Q53 C110 L111 H152 E153 H156
Enzyme Commision number 3.5.1.88: peptide deformylase.
Gene Ontology
Molecular Function
GO:0042586 peptide deformylase activity

View graph for
Molecular Function
External links
PDB RCSB:1zy1, PDBe:1zy1, PDBj:1zy1
PDBsum1zy1
PubMed16192279
UniProtQ9FV53|DEF1A_ARATH Peptide deformylase 1A, chloroplastic/mitochondrial (Gene Name=PDF1A)

[Back to BioLiP]