Structure of PDB 1zx4 Chain A Binding Site BS01

Receptor Information
>1zx4 Chain A (length=180) Species: 10678 (Punavirus P1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALQHSIREIGLRLMRMKNDGMSQKDIAAKEGLSQAKVTRALQAASAPEEL
VALFPVQSELTFSDYKTLCAVGDEMGNKNLEFDQLIQNISPEINDILSIE
MAEDEVKNKILRLITKEASLLTDKGSKDKSVVTELWKFEDKDRFARKRVK
GRAFSYEFNRLSKELQEELDRMIGHILRKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zx4 Structures of ParB bound to DNA reveal mechanism of partition complex formation.
Resolution2.98 Å
Binding residue
(original residue number in PDB)
S167 Q168 K169 T183 R184 Q187
Binding residue
(residue number reindexed from 1)
S22 Q23 K24 T38 R39 Q42
Enzymatic activity
Enzyme Commision number ?
External links