Structure of PDB 1zw2 Chain A Binding Site BS01

Receptor Information
>1zw2 Chain A (length=251) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAA
VSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPY
SVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEV
VETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKE
LLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQL
T
Ligand information
>1zw2 Chain B (length=21) Species: 9031 (Gallus gallus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ILEAAKSIAAATSALVKAASA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zw2 Mapping and consensus sequence identification for multiple vinculin binding sites within the talin rod
Resolution2.1 Å
Binding residue
(original residue number in PDB)		I11 V15 Q18 L22 M25 P42 V46 A49 L53 V56 I114 T118 L121 F125
Binding residue
(residue number reindexed from 1)		I12 V16 Q19 L23 M26 P43 V47 A50 L54 V57 I115 T119 L122 F126
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005198 structural molecule activity
GO:0051015 actin filament binding
Biological Process
GO:0007155 cell adhesion
Cellular Component
GO:0015629 actin cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1zw2, PDBe:1zw2, PDBj:1zw2
PDBsum1zw2
PubMed16135522
UniProtP12003|VINC_CHICK Vinculin (Gene Name=VCL)

[Back to BioLiP]