Structure of PDB 1zvz Chain A Binding Site BS01

Receptor Information
>1zvz Chain A (length=253) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAA
VSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPY
SVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEV
VETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKE
LLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQL
TSW
Ligand information
>1zvz Chain B (length=22) Species: 9031 (Gallus gallus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EMVRQARILAQATSDLVNAIKA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zvz Mapping and consensus sequence identification for multiple vinculin binding sites within the talin rod
Resolution1.8 Å
Binding residue
(original residue number in PDB)		S10 I11 V15 Q18 H21 M25 L39 V46 A49 L53 G57 I114 F125
Binding residue
(residue number reindexed from 1)		S11 I12 V16 Q19 H22 M26 L40 V47 A50 L54 G58 I115 F126
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005198 structural molecule activity
GO:0051015 actin filament binding
Biological Process
GO:0007155 cell adhesion
Cellular Component
GO:0015629 actin cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1zvz, PDBe:1zvz, PDBj:1zvz
PDBsum1zvz
PubMed16135522
UniProtP12003|VINC_CHICK Vinculin (Gene Name=VCL)

[Back to BioLiP]