Structure of PDB 1zvs Chain A Binding Site BS01

Receptor Information
>1zvs Chain A (length=278) Species: 9544 (Macaca mulatta) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMKYFYTSMSRPGRGQPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WVEQEGPEYWDRETRNMKTETQNAPVNLRTLLRYYNQSEAGSHTLQRMVG
CDLGPDGRLLRGYEQYAYDGKDYIALNEDLRSWTAADVAAQNTQRKWEAA
DVAESMRAYLEGQCVEWLPRYLEKGKETLQRTDPPKTHVTHHPVSDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPHTLKWEPHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zvs First glimpse of the peptide presentation by rhesus macaque MHC class I: crystal structures of Mamu-A*01 complexed with two immunogenic SIV epitopes and insights into CTL escape.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		Y7 Y9 R62 E63 N66 M67 E70 N73 N77 L81 Y84 T143 K146 W147 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 Y9 R62 E63 N66 M67 E70 N73 N77 L81 Y84 T143 K146 W147 Y159 W167 Y171
External links