Structure of PDB 1zsg Chain A Binding Site BS01

Receptor Information
>1zsg Chain A (length=65) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNG
RTGWFPSNYVREVKA
Ligand information
>1zsg Chain B (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DATPPPVIAPRPEHTKSVYTRS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zsg Structural Analysis of the SH3 Domain of beta-PIX and Its Interaction with alpha-p21 Activated Kinase (PAK)
ResolutionN/A
Binding residue
(original residue number in PDB)		T20 D23 G42 W43 P56 N58 Y59
Binding residue
(residue number reindexed from 1)		T20 D23 G42 W43 P56 N58 Y59
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1zsg, PDBe:1zsg, PDBj:1zsg
PDBsum1zsg
PubMed16101281
UniProtQ14155|ARHG7_HUMAN Rho guanine nucleotide exchange factor 7 (Gene Name=ARHGEF7)

[Back to BioLiP]