Structure of PDB 1zse Chain A Binding Site BS01

Receptor Information
>1zse Chain A (length=129) Species: 12022 (Escherichia phage MS2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQ
SSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLSMELTIPIFATNSD
CELIVKAMQGLLKDGNPIPSAIAANSGIY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zse Structural Basis of RNA Binding Discrimination between Bacteriophages Qbeta and MS2
Resolution3.0 Å
Binding residue
(original residue number in PDB)
T45 S47 T59 Y85
Binding residue
(residue number reindexed from 1)
T45 S47 T59 Y85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005198 structural molecule activity
GO:0042802 identical protein binding
Biological Process
GO:0006417 regulation of translation
GO:1904972 negative regulation of viral translation
Cellular Component
GO:0019028 viral capsid
GO:0039617 T=3 icosahedral viral capsid

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1zse, PDBe:1zse, PDBj:1zse
PDBsum1zse
PubMed16531233
UniProtP03612|CAPSD_BPMS2 Capsid protein

[Back to BioLiP]