Structure of PDB 1zs4 Chain A Binding Site BS01

Receptor Information
>1zs4 Chain A (length=82) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMANKRNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKRDWIP
KFSMLLAVLEWGVVDDDMARLARQVAAILTNK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zs4 Crystal Structure of Bacteriophage lambdacII and Its DNA Complex.
Resolution1.7 Å
Binding residue
(original residue number in PDB)
G25 T26 E27 K37 S38 S41 R42 K44
Binding residue
(residue number reindexed from 1)
G26 T27 E28 K38 S39 S42 R43 K45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1zs4, PDBe:1zs4, PDBj:1zs4
PDBsum1zs4
PubMed16039594
UniProtP03042|RPC2_LAMBD Transcriptional activator II (Gene Name=cII)

[Back to BioLiP]