Structure of PDB 1zms Chain A Binding Site BS01

Receptor Information
>1zms Chain A (length=192) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYK
RRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFV
IMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTG
EMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP
Ligand information
>1zms Chain B (length=7) Species: 10378 (Human herpesvirus 4 strain RAJI) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PQQATDD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zms LMP1 protein from the Epstein Barr virus is a structural CD40 decoy in B lymphocytes fro binding to TRAF3
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R393 Y395 D399 F410 F448 S456 I466 A467 S468 G469 P471
Binding residue
(residue number reindexed from 1)		R81 Y83 D87 F98 F136 S144 I154 A155 S156 G157 P159
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0005164 tumor necrosis factor receptor binding
Biological Process
GO:0001817 regulation of cytokine production
GO:0008063 Toll signaling pathway
GO:0032088 negative regulation of NF-kappaB transcription factor activity
GO:0033209 tumor necrosis factor-mediated signaling pathway
GO:0045087 innate immune response
GO:0050688 regulation of defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1zms, PDBe:1zms, PDBj:1zms
PDBsum1zms
PubMed16009714
UniProtQ13114|TRAF3_HUMAN TNF receptor-associated factor 3 (Gene Name=TRAF3)

[Back to BioLiP]