Structure of PDB 1zm5 Chain A Binding Site BS01

Receptor Information
>1zm5 Chain A (length=293) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLSHMVLTRQDIGRAASYYEDGADDYYAKDGDASEWQGKGAEELGLSGEV
DSKRFRELLAGNIGEGHRIMRSATRQDSKERIGLDLTFSAPKSVSLQALV
AGDAEIIKAHDRAVARTLEQAEARAQARQKIQGKTRIETTGNLVIGKFRH
ETSRERDPQLHTHAVILNMTKRSDGQWRALKNDEIVKATRYLGAVYNAEL
AHELQKLGYQLRYGKDGNFDLAHIDRQQIEGFSKRTEQIAEWYAARGLDP
NSVSLEQKQAAKVLSRAKKTSVDREALRAEWQATAKELGIDFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zm5 Unveiling the Molecular Mechanism of a Conjugative Relaxase: The Structure of TrwC Complexed with a 27-mer DNA Comprising the Recognition Hairpin and the Cleavage Site
Resolution2.5 Å
Binding residue
(original residue number in PDB)		M1 L2 H4 R14 S72 A73 R75 Q76 K79 R81 S89 A90 K92 R128 Q129 K130 Q132 R154 Q159 R172 R178 A179 N182 D183 V186 T189 N218 R226 S233 R235 T236 I239 K258 K262 R266
Binding residue
(residue number reindexed from 1)		M1 L2 H4 R14 S72 A73 R75 Q76 K79 R81 S89 A90 K92 R128 Q129 K130 Q132 R154 Q159 R172 R178 A179 N182 D183 V186 T189 N218 R226 S233 R235 T236 I239 K258 K262 R266
Enzymatic activity
Enzyme Commision number ?
External links