Structure of PDB 1zl3 Chain A Binding Site BS01

Receptor Information
>1zl3 Chain A (length=302) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDINGVLLLDKPQGMSSNDALQKVKRIYNANRAGHTGALNPLATGMLPIC
LGEATKFSQYLLDSDKRYRVIARLGQRTDTSDADGQIVEERPVTFSAEQL
AAALDTFRGDIEQIPSMYSALKYQGKKLYEYARQGIEVPREARPITVYEL
LFIRHEGNELELEIHCSKGTYIRTIIDDLGEKLGCGAHVIYLRRLAVSKY
PVERMVTLEHLRELVEQAEQQDIPAAELLDPLLMPMDSPASDYPVVNLPL
TSSVYFKNGNPVRTSGAPLEGLVRVTEGENGKFIGMGEIDDEGRVAPRRL
VV
Ligand information
>1zl3 Chain B (length=22) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcaacgguucgaucccguugc
.<<<<<<<.......>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zl3 Precursor complex structure of pseudouridine synthase TruB suggests coupling of active site perturbations to an RNA-sequestering peripheral protein domain
Resolution2.8 Å
Binding residue
(original residue number in PDB)		S24 N26 A41 G42 H43 G45 A46 N48 T63 S66 Q67 L70 K74 Y76 T88 D90 Y126 S127 A128 L129 K130 Q132 G133 Y137 R141 R151 K176 G177 T178 Y179 I180 R181 L200
Binding residue
(residue number reindexed from 1)		S16 N18 A33 G34 H35 G37 A38 N40 T55 S58 Q59 L62 K66 Y68 T80 D82 Y118 S119 A120 L121 K122 Q124 G125 Y129 R133 R143 K168 G169 T170 Y171 I172 R173 L192
Enzymatic activity
Enzyme Commision number 5.4.99.25: tRNA pseudouridine(55) synthase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0009982 pseudouridine synthase activity
GO:0016853 isomerase activity
GO:0106029 tRNA pseudouridine synthase activity
GO:0140098 catalytic activity, acting on RNA
GO:0160148 tRNA pseudouridine(55) synthase activity
Biological Process
GO:0001522 pseudouridine synthesis
GO:0006396 RNA processing
GO:0006400 tRNA modification
GO:0008033 tRNA processing
GO:0009451 RNA modification
GO:0031119 tRNA pseudouridine synthesis
GO:0061818 tRNA folding
GO:1990481 mRNA pseudouridine synthesis
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1zl3, PDBe:1zl3, PDBj:1zl3
PDBsum1zl3
PubMed15987897
UniProtP60340|TRUB_ECOLI tRNA pseudouridine synthase B (Gene Name=truB)

[Back to BioLiP]