Structure of PDB 1zh7 Chain A Binding Site BS01

Receptor Information
>1zh7 Chain A (length=243) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASIPHLILELLKCEPDEPQVQAKIMAYLQQEQSNRNRQEKLSAFGLLCKM
ADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVAHG
KEGTIFLVTGEHVDYSTIISHTEVAFNNLLSLAQELVVRLRSLQFDQREF
VCLKFLVLFSSDVKNLENLQLVEGVQEQVNAALLDYTVCNYPQQTEKFGQ
LLLRLPEIRAISKQAEDYLYYKHVNGDVPYNNLLIEMLHAKRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zh7 Structural and biochemical basis for selective repression of the orphan nuclear receptor liver receptor homolog 1 by small heterodimer partner
Resolution2.5 Å
Binding residue
(original residue number in PDB)
F373 R380 V390 Q393 M394 Q398 N549 E553
Binding residue
(residue number reindexed from 1)
F56 R63 V73 Q76 M77 Q81 N232 E236
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity

View graph for
Molecular Function
External links
PDB RCSB:1zh7, PDBe:1zh7, PDBj:1zh7
PDBsum1zh7
PubMed15976031
UniProtP45448|NR5A2_MOUSE Nuclear receptor subfamily 5 group A member 2 (Gene Name=Nr5a2)

[Back to BioLiP]