Structure of PDB 1zdt Chain A Binding Site BS01

Receptor Information

>1zdt Chain A (length=233) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PNVPELILQLLQLEPDEDQVRARILGSLPDQPAAFGLLCRMADQTFISIV
DWARRCMVFKELEVADQMTLLQNCWSELLVFDHIYRQVQHGKEGSILLVT
GQEVELTTVATQAGSLLHSLVLRAQELVLQLLALQLDRQEFVCLKFIILF
SLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHSGDKFQQLLLCLVEVR
ALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQ

Ligand information

>1zdt Chain P (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ENALLRYLLDKD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1zdt The crystal structures of human steroidogenic factor-1 and liver receptor homologue-1
Resolution	2.1 Å
Binding residue (original residue number in PDB)	R281 M295 Q299 E454 M455
Binding residue (residue number reindexed from 1)	R54 M68 Q72 E227 M228

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

View graph for
Molecular Function

External links

PDB	RCSB:1zdt, PDBe:1zdt, PDBj:1zdt
PDBsum	1zdt
PubMed	15897460
UniProt	Q13285\|STF1_HUMAN Steroidogenic factor 1 (Gene Name=NR5A1)

[Back to BioLiP]