Structure of PDB 1zbd Chain A Binding Site BS01

Receptor Information

>1zbd Chain A (length=177) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SHMFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIY
RNDKRIKLQIWDTAGLERYRTITTAYYRGAMGFILMYDITNEESFNAVQD
WSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEAS
AKDNINVKQTFERLVDVICEKMSESLD

Ligand information

Ligand ID

InChI

InChI=1S/Mg/q+2

InChIKey

JLVVSXFLKOJNIY-UHFFFAOYSA-N

SMILES

Software	SMILES
ACDLabs 10.04 OpenEye OEToolkits 1.5.0	[Mg+2]
CACTVS 3.341	[Mg++]

Formula

Name

MAGNESIUM ION

PDB chain

1zbd Chain A Residue 302 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1zbd Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	T36 T54
Binding residue (residue number reindexed from 1)	T21 T39
Annotation score	1

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0001671	ATPase activator activity
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0030674	protein-macromolecule adaptor activity
GO:0030742	GTP-dependent protein binding
GO:0031489	myosin V binding
GO:0051021	GDP-dissociation inhibitor binding
GO:0051117	ATPase binding

	Biological Process
GO:0001778	plasma membrane repair
GO:0003016	respiratory system process
GO:0006887	exocytosis
GO:0007005	mitochondrion organization
GO:0007274	neuromuscular synaptic transmission
GO:0007409	axonogenesis
GO:0009306	protein secretion
GO:0009791	post-embryonic development
GO:0010807	regulation of synaptic vesicle priming
GO:0014059	regulation of dopamine secretion
GO:0015031	protein transport
GO:0016079	synaptic vesicle exocytosis
GO:0016188	synaptic vesicle maturation
GO:0017156	calcium-ion regulated exocytosis
GO:0017157	regulation of exocytosis
GO:0030073	insulin secretion
GO:0030324	lung development
GO:0031630	regulation of synaptic vesicle fusion to presynaptic active zone membrane
GO:0032418	lysosome localization
GO:0032482	Rab protein signal transduction
GO:0036465	synaptic vesicle recycling
GO:0045055	regulated exocytosis
GO:0048172	regulation of short-term neuronal synaptic plasticity
GO:0048489	synaptic vesicle transport
GO:0048790	maintenance of presynaptic active zone structure
GO:0050975	sensory perception of touch
GO:0051602	response to electrical stimulus
GO:0051649	establishment of localization in cell
GO:0060478	acrosomal vesicle exocytosis
GO:0061670	evoked neurotransmitter secretion
GO:0097091	synaptic vesicle clustering
GO:0099161	regulation of presynaptic dense core granule exocytosis
GO:1903307	positive regulation of regulated secretory pathway
GO:1905684	regulation of plasma membrane repair
GO:2000300	regulation of synaptic vesicle exocytosis

	Cellular Component
GO:0001669	acrosomal vesicle
GO:0005737	cytoplasm
GO:0005764	lysosome
GO:0005768	endosome
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0008021	synaptic vesicle
GO:0030133	transport vesicle
GO:0030141	secretory granule
GO:0030424	axon
GO:0030672	synaptic vesicle membrane
GO:0031410	cytoplasmic vesicle
GO:0032991	protein-containing complex
GO:0042995	cell projection
GO:0043195	terminal bouton
GO:0045202	synapse
GO:0048471	perinuclear region of cytoplasm
GO:0048786	presynaptic active zone
GO:0098793	presynapse
GO:0098794	postsynapse
GO:0099503	secretory vesicle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1zbd, PDBe:1zbd, PDBj:1zbd
PDBsum	1zbd
PubMed	10025402
UniProt	P63012\|RAB3A_RAT Ras-related protein Rab-3A (Gene Name=Rab3a)

[Back to BioLiP]