Structure of PDB 1z3a Chain A Binding Site BS01

Receptor Information

>1z3a Chain A (length=156) Species: 562 (Escherichia coli)

SEVEFSHEYWMRHALTLAKRAWDEREVPVGAVLVHNNRVIGEGWNRPIGR
HDPTAHAEIMALRQGGLVMQNYRLIDATLYVTLEPCVMCAGAMIHSRIGR
VVFGARDAKTGAAGSLMDVLHHPGMNHRVEITEGILADECAALLSDFFRM
RRQEIK

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 1z3a Chain A Residue 301

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1z3a Structural and kinetic characterization of Escherichia coli TadA, the wobble-specific tRNA deaminase.
• Resolution: 2.03 Å
• Binding residue (original residue number in PDB): H68 C98 C101
• Binding residue (residue number reindexed from 1): H56 C86 C89
• Annotation score: 1

Enzymatic activity

• Catalytic site (original residue number in PDB): E70 E96 C98
• Catalytic site (residue number reindexed from 1): E58 E84 C86
• Enzyme Commision number: 3.5.4.33: tRNA(adenine(34)) deaminase.

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0008251 tRNA-specific adenosine deaminase activity
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding
• GO:0052717 tRNA-specific adenosine-34 deaminase activity

Biological Process

• GO:0002100 tRNA wobble adenosine to inosine editing
• GO:0006382 adenosine to inosine editing
• GO:0008033 tRNA processing

External links

• PDB: RCSB:1z3a, PDBe:1z3a, PDBj:1z3a
• PDBsum: 1z3a
• PubMed: 16700551
• UniProt: P68398|TADA_ECOLI tRNA-specific adenosine deaminase (Gene Name=tadA)