Structure of PDB 1yui Chain A Binding Site BS01

Receptor Information
>1yui Chain A (length=54) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKAKRAKHPPGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFA
KPGV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1yui The solution structure of a specific GAGA factor-DNA complex reveals a modular binding mode.
ResolutionN/A
Binding residue
(original residue number in PDB)		R14 K16 T21 E22 K23 R27 R44 Q45 R47 N48 R51
Binding residue
(residue number reindexed from 1)		R5 K7 T12 E13 K14 R18 R35 Q36 R38 N39 R42
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1yui, PDBe:1yui, PDBj:1yui
PDBsum1yui
PubMed9033593
UniProtQ08605|GAGA_DROME Transcription activator GAGA (Gene Name=Trl)

[Back to BioLiP]