Structure of PDB 1yok Chain A Binding Site BS01

Receptor Information
>1yok Chain A (length=236) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKLSTFGLMCKMADQT
LFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGS
IFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLK
FLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLR
LPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1yok Structural analyses reveal phosphatidyl inositols as ligands for the NR5 orphan receptors SF-1 and LRH-1.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		E358 R361 Q374 M375 Q379 L531 E534 M535
Binding residue
(residue number reindexed from 1)		E56 R59 Q72 M73 Q77 L229 E232 M233
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity

View graph for
Molecular Function
External links
PDB RCSB:1yok, PDBe:1yok, PDBj:1yok
PDBsum1yok
PubMed15707893
UniProtO00482|NR5A2_HUMAN Nuclear receptor subfamily 5 group A member 2 (Gene Name=NR5A2)

[Back to BioLiP]