Structure of PDB 1ymt Chain A Binding Site BS01

Receptor Information

>1ymt Chain A (length=235) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSSGGPNVPELILQLLQLEPEEDQVRARIVGCLQQPAPFSLLCRMADQTF
ISIVDWARRCMVFKELEVADQMTLLQNSWSELLVLDHIYRQVQYGKEDSI
LLVTGQEVELSTVAVQAGSLLHSLVLRAQELVLQLHALQLDRQEFVCLKF
LILFSLDVKFLNNHSLVKDAQEKANAALLDYTLSHYPHSGDKFQQLLLSL
VEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQA

Ligand information

>1ymt Chain B (length=10) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RPTILYALLS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1ymt Structural analyses reveal phosphatidyl inositols as ligands for the NR5 orphan receptors SF-1 and LRH-1
Resolution	1.2 Å
Binding residue (original residue number in PDB)	M296 E455
Binding residue (residue number reindexed from 1)	M72 E231

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

View graph for
Molecular Function

External links

PDB	RCSB:1ymt, PDBe:1ymt, PDBj:1ymt
PDBsum	1ymt
PubMed	15707893
UniProt	P33242\|STF1_MOUSE Steroidogenic factor 1 (Gene Name=Nr5a1)

[Back to BioLiP]