Structure of PDB 1ym0 Chain A Binding Site BS01

Receptor Information

>1ym0 Chain A (length=238) Species: 6396 (Eisenia fetida) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IVGGIEARPYEFPWQVSVRRKSSDSHFCGGSIINDRWVVCAAHCMQGEAP
ALVSLVVGEHDSSAASTVRQTHDVDSIFVNENYDPATLENDVSVIKTAVA
ITFDINVGPICAPDPANDYVYRKSQCSGWGTINSGGVCCPAVLRYVTLNI
TTNAFCDAVYTSDTIYDDMICATDNTGMTDRDSCQGDSGGPLSVKDGSGI
FSLVGIVSWGIGCASGYPGVYSRVGFHAGWITDTITNN

Ligand information

>1ym0 Chain B (length=27) Species: 6396 (Eisenia fetida) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

QPPVWYPGGQCGVSQYSDAGDMELPPG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1ym0 Crystal structure of earthworm fibrinolytic enzyme component B: a novel, glycosylated two-chained trypsin.
Resolution	2.06 Å
Binding residue (original residue number in PDB)	R23 P24 E26 W29 I47 N48 F114 I116 P120 I121 C122 A123 P124 D125 K135 Y157 T159 L160 N186 R188 K202 I206 F207 I238 T239
Binding residue (residue number reindexed from 1)	R8 P9 E11 W14 I33 N34 F103 I105 P109 I110 C111 A112 P113 D114 K123 Y145 T147 L148 N175 R181 K195 I200 F201 I231 T232

Enzymatic activity

Catalytic site (original residue number in PDB)	H57 D102 Q192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1)	H43 D91 Q185 G186 D187 S188 G189
Enzyme Commision number	3.4.21.-

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity
GO:0016301	kinase activity
GO:0046872	metal ion binding

	Biological Process
GO:0006508	proteolysis
GO:0016310	phosphorylation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1ym0, PDBe:1ym0, PDBj:1ym0
PDBsum	1ym0
PubMed	15826663
UniProt	Q3HR18

[Back to BioLiP]