Structure of PDB 1yfh Chain A Binding Site BS01

Receptor Information
>1yfh Chain A (length=165) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGVPAPAAVLGGPEPLMQCTA
WLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISY
QQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAV
KEWLLAHEGHRLGKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1yfh The structure of the human AGT protein bound to DNA and its implications for damage detection.
Resolution3.01 Å
Binding residue
(original residue number in PDB)		Y114 Q115 A127 R128 G131 M134 R135 N137 P140 C145 S151 Y158 S159 G160
Binding residue
(residue number reindexed from 1)		Y100 Q101 A113 R114 G117 M120 R121 N123 P126 C131 S137 Y144 S145 G146
Binding affinityPDBbind-CN: Kd=0.8uM
Enzymatic activity
Enzyme Commision number 2.1.1.63: methylated-DNA--[protein]-cysteine S-methyltransferase.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0003908 methylated-DNA-[protein]-cysteine S-methyltransferase activity
Biological Process
GO:0006281 DNA repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1yfh, PDBe:1yfh, PDBj:1yfh
PDBsum1yfh
PubMed15964013
UniProtP16455|MGMT_HUMAN Methylated-DNA--protein-cysteine methyltransferase (Gene Name=MGMT)

[Back to BioLiP]