Structure of PDB 1ydi Chain A Binding Site BS01

Receptor Information
>1ydi Chain A (length=256) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHHHHMPVFHTRTIESILEPVAQQISHLVIMHEAIPDLTAPVAAVQAAVS
NLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSV
PARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVE
TMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELL
PVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTS
WDEDAW
Ligand information
>1ydi Chain B (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VGWEQLLTTIARTINEVENQILTR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ydi Structural Dynamics of {alpha}-Actinin-Vinculin Interactions.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		V16 Q19 H22 L23 M26 L40 A50 L54 V57 L70 L108 I109 T119 F126
Binding residue
(residue number reindexed from 1)		V21 Q24 H27 L28 M31 L38 A48 L52 V55 L68 L106 I107 T117 F124
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005198 structural molecule activity
GO:0051015 actin filament binding
Biological Process
GO:0007155 cell adhesion
Cellular Component
GO:0015629 actin cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ydi, PDBe:1ydi, PDBj:1ydi
PDBsum1ydi
PubMed15988023
UniProtP18206|VINC_HUMAN Vinculin (Gene Name=VCL)

[Back to BioLiP]