Structure of PDB 1ycq Chain A Binding Site BS01

Receptor Information
>1ycq Chain A (length=88) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKLVQPTPLLLSLLKSAGAQKETFTMKEVIYHLGQYIMAKQLYDEKQQHI
VHCSNDPLGELFGVQEFSVKEPRRLYAMISRNLVSANV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ycq Structure of the MDM2 oncoprotein bound to the p53 tumor suppressor transactivation domain.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		I50 G54 I57 M58 Y63 Q68 V89 K90 P92 Y96
Binding residue
(residue number reindexed from 1)		I30 G34 I37 M38 Y43 Q48 V69 K70 P72 Y76
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ycq, PDBe:1ycq, PDBj:1ycq
PDBsum1ycq
PubMed8875929
UniProtP56273|MDM2_XENLA E3 ubiquitin-protein ligase Mdm2 (Gene Name=mdm2)

[Back to BioLiP]