Structure of PDB 1xsd Chain A Binding Site BS01

Receptor Information
>1xsd Chain A (length=125) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TNKQVEISMAEWDVMNIIWDKKSVSANEIVVEIQKYKEVSDKTIRTLITR
LYKKEIIKRYKSENIYFYSSNIKEDDIKMKTAKTFLNKLYGGDMKSLVLN
FAKNEELNNKEIEELRDILNDISKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1xsd Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
Resolution2.7 Å
Binding residue
(original residue number in PDB)		S9 A11 S41 T44 T47 R51
Binding residue
(residue number reindexed from 1)		S8 A10 S40 T43 T46 R50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0010468 regulation of gene expression
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1xsd, PDBe:1xsd, PDBj:1xsd
PDBsum1xsd
PubMed15716455
UniProtP0A042|BLAI_STAAU Penicillinase repressor (Gene Name=blaI)

[Back to BioLiP]