Structure of PDB 1xpx Chain A Binding Site BS01

Receptor Information
>1xpx Chain A (length=144) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSN
FREFYYIQMEKYARQAVTESELYRVLNLHYNRNNHIEVPQNFRFVVESTL
REFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1xpx Structural Basis of Prospero-DNA Interaction: Implications for Transcription Regulationin Developing Cells.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		K1282 K1290 K1376
Binding residue
(residue number reindexed from 1)		K38 K46 K119
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1xpx, PDBe:1xpx, PDBj:1xpx
PDBsum1xpx
PubMed15837198
UniProtP29617|PROS_DROME Homeobox protein prospero (Gene Name=pros)

[Back to BioLiP]