Structure of PDB 1xjv Chain A Binding Site BS01

Receptor Information
>1xjv Chain A (length=291) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNV
KLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQGITSSGFASLT
FEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSTLLKLCDVQP
MQYFDLTCQLLGKAEVDGASFLLKVWDGTRTPFPSWRVLIQDLVLEGDLS
HIHRLQNLTIDILVYDNHVHVARSLKVGSFLRIYSLHTKLQSMNSENQTM
LSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLTA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1xjv Structure of human POT1 bound to telomeric single-stranded DNA provides a model for chromosome end-protection
Resolution1.73 Å
Binding residue
(original residue number in PDB)		F31 K33 Y36 S38 K39 G40 T41 D42 T48 L60 F62 Y89 Q94 Y161 Y223 D224 S243 H245 H266 G267 S270 Y271 R273
Binding residue
(residue number reindexed from 1)		F26 K28 Y31 S33 K34 G35 T36 D37 T43 L55 F57 Y84 Q89 Y153 Y215 D216 S235 H237 H258 G259 S262 Y263 R265
Binding affinityPDBbind-CN: Kd=9.2nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0043047 single-stranded telomeric DNA binding
Biological Process
GO:0000723 telomere maintenance
Cellular Component
GO:0000781 chromosome, telomeric region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1xjv, PDBe:1xjv, PDBj:1xjv
PDBsum1xjv
PubMed15558049
UniProtQ9NUX5|POTE1_HUMAN Protection of telomeres protein 1 (Gene Name=POT1)

[Back to BioLiP]