Structure of PDB 1xjs Chain A Binding Site BS01

Receptor Information

>1xjs Chain A (length=147) Species: 1423 (Bacillus subtilis)

MSFNANLDTLYRQVIMDHYKNPRNKGVLNDSIVVDMNNPTCGDRIRLTMK
LDGDIVEDAKFEGEGCSISMASASMMTQAIKGKDIETALSMSKIFSDMMQ
GKEYDDSIDLGDIEALQGVSKFPARIKCATLSWKALEKGVAKEEGGN

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 1xjs Chain A Residue 150

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1xjs Solution structure of Iron-Sulfur cluster assembly protein IscU from Bacillus subtilis, with Zinc bound at the active site. Northeast Structural Genomics Consortium Target SR17.
• Resolution: N/A
• Binding residue (original residue number in PDB): C41 D43
• Binding residue (residue number reindexed from 1): C41 D43
• Annotation score: 4

Enzymatic activity

• Enzyme Commision number: 2.-.-.-

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0008198 ferrous iron binding
• GO:0016740 transferase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0006879 intracellular iron ion homeostasis
• GO:0016226 iron-sulfur cluster assembly

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1xjs, PDBe:1xjs, PDBj:1xjs
• PDBsum: 1xjs
• UniProt: O32163|SUFU_BACSU Zinc-dependent sulfurtransferase SufU (Gene Name=sufU)