Structure of PDB 1xiu Chain A Binding Site BS01

Receptor Information

>1xiu Chain A (length=221) Species: 6526 (Biomphalaria glabrata) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NDMPVEQILEAELAVDPKIDTYIDAQKDPVTNICQAADKQLFTLVEWAKR
IPHFTELPLEDQVILLRAGWNELLIAGFSHRSIMAKDGILLATGLHVHRS
SAHQAGVGTIFDRVLTELVAKMRDMKMDKTELGCLRAVVLFNPDAKGLTA
VQEVEQLREKVYASLEEYTKSRYPEEPGRFAKLLLRLPALRSIGLKCLEH
LFFFKLIGDQPIDTFLMEMLE

Ligand information

>1xiu Chain E (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

HKILHRLLQEGS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1xiu Crystal Structure of a Novel Tetrameric Complex of Agonist-bound Ligand-binding Domain of Biomphalaria glabrata Retinoid X Receptor.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	K258 L268 V272 R276
Binding residue (residue number reindexed from 1)	K49 L59 V63 R67

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003707	nuclear steroid receptor activity
GO:0008270	zinc ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1xiu, PDBe:1xiu, PDBj:1xiu
PDBsum	1xiu
PubMed	16274693
UniProt	Q8T5C6\|RXR_BIOGL Retinoic acid receptor RXR (Gene Name=RXR)

[Back to BioLiP]