Structure of PDB 1xbr Chain A Binding Site BS01

Receptor Information
>1xbr Chain A (length=184) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELKVSLEERDLWTRFKELTNEMIVTKNGRRMFPVLKVSMSGLDPNAMYTV
LLDFVAADNHRWKYVNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKDP
VSFSKVKLTNKMNGGGQIMLNSLHKYEPRIHIVRVGGTQRMITSHSFPET
QFIAVTAYQNEEITALKIKHNPFAKAFLDAKERN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1xbr Crystallographic structure of the T domain-DNA complex of the Brachyury transcription factor.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
R99 K149 S160 T194 P210 K213 A214
Binding residue
(residue number reindexed from 1)
R61 K111 S122 T156 P172 K175 A176
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1xbr, PDBe:1xbr, PDBj:1xbr
PDBsum1xbr
PubMed9349824
UniProtP24781|TBXT_XENLA T-box transcription factor T (Gene Name=tbxt)

[Back to BioLiP]