Structure of PDB 1xb7 Chain A Binding Site BS01

Receptor Information

>1xb7 Chain A (length=215) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LEVLFQGPVNALVSHLLVVEPEKLYAMAVATLCDLFDREIVVTISWAKSI
PGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEG
ARAAGLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAE
AVEQLREALHEALLEYEAGRRRAGRLLLTLPLLRQTAGKVLAHFYGVKLE
GKVPMHKLFLEMLEA

Ligand information

>1xb7 Chain P (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SELLKYLTT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1xb7 Evidence for Ligand-independent Transcriptional Activation of the Human Estrogen-related Receptor {alpha} (ERR{alpha}): CRYSTAL STRUCTURE OF ERR{alpha} LIGAND BINDING DOMAIN IN COMPLEX WITH PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR COACTIVATOR-1{alpha}
Resolution	2.5 Å
Binding residue (original residue number in PDB)	K340 Q353 E512
Binding residue (residue number reindexed from 1)	K48 Q61 E211

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:1xb7, PDBe:1xb7, PDBj:1xb7
PDBsum	1xb7
PubMed	15337744
UniProt	P11474\|ERR1_HUMAN Steroid hormone receptor ERR1 (Gene Name=ESRRA)

[Back to BioLiP]