Structure of PDB 1x0f Chain A Binding Site BS01

Receptor Information

>1x0f Chain A (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITF
KEEEPVKKIMEKKYHNVGLSKCEIKVAMS

Ligand information

>1x0f Chain B (length=4) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tagg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1x0f Structure of hnRNP D complexed with single-stranded telomere DNA and unfolding of the quadruplex by heterogeneous nuclear ribonucleoprotein D.
Resolution	N/A
Binding residue (original residue number in PDB)	K183 F185 G187 G188 E212 P214 R222 R223 F225 F227 E253 K255 M258
Binding residue (residue number reindexed from 1)	K3 F5 G7 G8 E32 P34 R42 R43 F45 F47 E73 K75 M78

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:1x0f, PDBe:1x0f, PDBj:1x0f
PDBsum	1x0f
PubMed	15734733
UniProt	Q14103\|HNRPD_HUMAN Heterogeneous nuclear ribonucleoprotein D0 (Gene Name=HNRNPD)

[Back to BioLiP]