Structure of PDB 1wy9 Chain A Binding Site BS01

Receptor Information
>1wy9 Chain A (length=111) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDID
IMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSA
ILRMILMYEEK
Ligand information
Ligand IDCA
InChIInChI=1S/Ca/q+2
InChIKeyBHPQYMZQTOCNFJ-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Ca++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Ca+2]
FormulaCa
NameCALCIUM ION
ChEMBL
DrugBankDB14577
ZINC
PDB chain1wy9 Chain A Residue 148 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1wy9 X-ray Structures of the Microglia/Macrophage-specific Protein Iba1 from Human and Mouse Demonstrate Novel Molecular Conformation Change Induced by Calcium binding
Resolution2.1 Å
Binding residue
(original residue number in PDB)		S94 G96 S97 T100
Binding residue
(residue number reindexed from 1)		S78 G80 S81 T84
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0046872 metal ion binding
GO:0051015 actin filament binding
Biological Process
GO:0001774 microglial cell activation
GO:0006911 phagocytosis, engulfment
GO:0006954 inflammatory response
GO:0008284 positive regulation of cell population proliferation
GO:0016601 Rac protein signal transduction
GO:0030041 actin filament polymerization
GO:0030046 parallel actin filament bundle assembly
GO:0030335 positive regulation of cell migration
GO:0032722 positive regulation of chemokine production
GO:0032755 positive regulation of interleukin-6 production
GO:0034599 cellular response to oxidative stress
GO:0042102 positive regulation of T cell proliferation
GO:0048661 positive regulation of smooth muscle cell proliferation
GO:0048662 negative regulation of smooth muscle cell proliferation
GO:0050921 positive regulation of chemotaxis
GO:0051017 actin filament bundle assembly
GO:0051764 actin crosslink formation
GO:0071346 cellular response to type II interferon
GO:0071672 negative regulation of smooth muscle cell chemotaxis
GO:0071673 positive regulation of smooth muscle cell chemotaxis
GO:0071677 positive regulation of mononuclear cell migration
GO:0090026 positive regulation of monocyte chemotaxis
GO:0090271 positive regulation of fibroblast growth factor production
GO:0097178 ruffle assembly
GO:1900087 positive regulation of G1/S transition of mitotic cell cycle
GO:2000406 positive regulation of T cell migration
Cellular Component
GO:0001726 ruffle
GO:0001891 phagocytic cup
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005884 actin filament
GO:0005886 plasma membrane
GO:0030027 lamellipodium
GO:0032587 ruffle membrane
GO:0042995 cell projection
GO:0048471 perinuclear region of cytoplasm
GO:0097386 glial cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1wy9, PDBe:1wy9, PDBj:1wy9
PDBsum1wy9
PubMed17011575
UniProtO70200|AIF1_MOUSE Allograft inflammatory factor 1 (Gene Name=Aif1)

[Back to BioLiP]