Structure of PDB 1wwf Chain A Binding Site BS01

Receptor Information
>1wwf Chain A (length=56) Species: 11801 (Moloney murine leukemia virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATVVSGQKQDRQGGERRRSQLDRDQCAYCKEKGHWAKDCPKKPRGPRGPR
PQTSLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1wwf Composition and sequence-dependent binding of RNA to the nucleocapsid protein of Moloney murine leukemia virus(,)
ResolutionN/A
Binding residue
(original residue number in PDB)		R16 L21 D22 R23 Q25 A27 Y28 A36 K37 K41 K42 P43
Binding residue
(residue number reindexed from 1)		R16 L21 D22 R23 Q25 A27 Y28 A36 K37 K41 K42 P43
Binding affinityPDBbind-CN: Kd=94nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:1wwf, PDBe:1wwf, PDBj:1wwf
PDBsum1wwf
PubMed15751950
UniProtP03332|GAG_MLVMS Gag polyprotein (Gene Name=gag)

[Back to BioLiP]