Structure of PDB 1wwe Chain A Binding Site BS01

Receptor Information
>1wwe Chain A (length=56) Species: 11801 (Moloney murine leukemia virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATVVSGQKQDRQGGERRRSQLDRDQCAYCKEKGHWAKDCPKKPRGPRGPR
PQTSLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1wwe Composition and sequence-dependent binding of RNA to the nucleocapsid protein of Moloney murine leukemia virus(,)
ResolutionN/A
Binding residue
(original residue number in PDB)		G14 E15 L21 D22 R23 Q25 A27 Y28 A36 K41 K42
Binding residue
(residue number reindexed from 1)		G14 E15 L21 D22 R23 Q25 A27 Y28 A36 K41 K42
Binding affinityPDBbind-CN: Kd=170nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:1wwe, PDBe:1wwe, PDBj:1wwe
PDBsum1wwe
PubMed15751950
UniProtP03332|GAG_MLVMS Gag polyprotein (Gene Name=gag)

[Back to BioLiP]