Structure of PDB 1wwd Chain A Binding Site BS01

Receptor Information
>1wwd Chain A (length=56) Species: 11801 (Moloney murine leukemia virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATVVSGQKQDRQGGERRRSQLDRDQCAYCKEKGHWAKDCPKKPRGPRGPR
PQTSLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1wwd Composition and sequence-dependent binding of RNA to the nucleocapsid protein of Moloney murine leukemia virus(,)
ResolutionN/A
Binding residue
(original residue number in PDB)		L21 D22 R23 Q25 A27 Y28 K30 A36 K42
Binding residue
(residue number reindexed from 1)		L21 D22 R23 Q25 A27 Y28 K30 A36 K42
Binding affinityPDBbind-CN: Kd=250nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:1wwd, PDBe:1wwd, PDBj:1wwd
PDBsum1wwd
PubMed15751950
UniProtP03332|GAG_MLVMS Gag polyprotein (Gene Name=gag)

[Back to BioLiP]