Structure of PDB 1wtw Chain A Binding Site BS01

Receptor Information
>1wtw Chain A (length=66) Species: 2285 (Sulfolobus acidocaldarius) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVKVKFKYKGEEKEVDTSKIKKVWRAGKMVSFTYDDNGKTGRGAVSEKDA
PKELLDMLARAEREKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1wtw Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
Resolution2.2 Å
Binding residue
(original residue number in PDB)		W24 R25 M29 S31 T33 T40 R42
Binding residue
(residue number reindexed from 1)		W24 R25 M29 S31 T33 T40 R42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004521 RNA endonuclease activity
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1wtw, PDBe:1wtw, PDBj:1wtw
PDBsum1wtw
PubMed15653643
UniProtP13123|DN7D_SULAC DNA-binding protein 7d (Gene Name=Saci_0064)

[Back to BioLiP]