Structure of PDB 1wtb Chain A Binding Site BS01

Receptor Information

>1wtb Chain A (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITF
KEEEPVKKIMEKKYHNVGLSKCEIKVAMS

Ligand information

>1wtb Chain B (length=4) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tagg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1wtb Structure of hnRNP D complexed with single-stranded telomere DNA and unfolding of the quadruplex by heterogeneous nuclear ribonucleoprotein D
Resolution	N/A
Binding residue (original residue number in PDB)	F185 G187 G188 P214 M215 K218 K221 R222 R223 F225 F227 E253 K255 A257 M258 S259
Binding residue (residue number reindexed from 1)	F5 G7 G8 P34 M35 K38 K41 R42 R43 F45 F47 E73 K75 A77 M78 S79

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:1wtb, PDBe:1wtb, PDBj:1wtb
PDBsum	1wtb
PubMed	15734733
UniProt	Q14103\|HNRPD_HUMAN Heterogeneous nuclear ribonucleoprotein D0 (Gene Name=HNRNPD)

[Back to BioLiP]