Structure of PDB 1wby Chain A Binding Site BS01

Receptor Information
>1wby Chain A (length=275) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPW
MEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGC
DLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSG
AAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTL
RCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPL
GKEQNYTCRVYHEGLPEPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1wby Crystal Structures of Murine Mhc Class I H-2 D(B) and K(B) Molecules in Complex with Ctl Epitopes from Influenza a Virus: Implications for Tcr Repertoire Selection and Immunodominance
Resolution2.3 Å
Binding residue
(original residue number in PDB)
Y7 E63 K66 Q70 W73 V76 S77 N80 L81 Y84 Q97 Y123 T143 K146 W147 A152 H155 Y156 Y159 E163 W167 Y171
Binding residue
(residue number reindexed from 1)
Y6 E62 K65 Q69 W72 V75 S76 N79 L80 Y83 Q96 Y122 T142 K145 W146 A151 H154 Y155 Y158 E162 W166 Y170
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1wby, PDBe:1wby, PDBj:1wby
PDBsum1wby
PubMed15644207
UniProtP01899|HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain (Gene Name=H2-D1)

[Back to BioLiP]