Structure of PDB 1wa7 Chain A Binding Site BS01

Receptor Information
>1wa7 Chain A (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFI
PSNYVAKLNT
Ligand information
>1wa7 Chain B (length=22) Species: 10381 (Saimiriine gammaherpesvirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WDPGMPTPPLPPRPANLGERQA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1wa7 Structural Investigation of the Binding of a Herpesviral Protein to the SH3 Domain of Tyrosine Kinase Lck.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y17 P18 Y19 H23 D25 D26 H41 E43 W44 F57 P59 N61 Y62
Binding residue
(residue number reindexed from 1)		Y9 P10 Y11 H15 D17 D18 H33 E35 W36 F49 P51 N53 Y54
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:1wa7, PDBe:1wa7, PDBj:1wa7
PDBsum1wa7
PubMed11955060
UniProtP07948|LYN_HUMAN Tyrosine-protein kinase Lyn (Gene Name=LYN)

[Back to BioLiP]