Structure of PDB 1w80 Chain A Binding Site BS01

Receptor Information
>1w80 Chain A (length=248) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGILAPLAPGSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIF
YGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVINIE
CISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRW
KQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGA
GIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1w80 Evolving Nature of the Ap2 Alpha-Appendage Hub During Clathrin-Coated Vesicle Endocytosis.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		N713 G714 G725 L726 K727 F740 G742 N743 G780 Q782
Binding residue
(residue number reindexed from 1)		N23 G24 G35 L36 K37 F50 G52 N53 G90 Q92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006886 intracellular protein transport
GO:0016192 vesicle-mediated transport
Cellular Component
GO:0030117 membrane coat
GO:0030131 clathrin adaptor complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1w80, PDBe:1w80, PDBj:1w80
PDBsum1w80
PubMed15496985
UniProtP17427|AP2A2_MOUSE AP-2 complex subunit alpha-2 (Gene Name=Ap2a2)

[Back to BioLiP]