Structure of PDB 1w3c Chain A Binding Site BS01

Receptor Information

>1w3c Chain A (length=173) Species: 11104 (Hepatitis C virus (isolate 1))

ITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVC
WTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSS
DLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVG
IFRAAVCTRGVAKAVDFIPVESM

Ligand information

>1w3c Chain C (length=12) Species: 11104 (Hepatitis C virus (isolate 1))

GSVVIVGRIILS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1w3c The Design and Enzyme-Bound Crystal Structure of Indoline Based Peptidomimetic Inhibitors of Hepatitis C Virus Ns3 Protease
• Resolution: 2.3 Å
• Binding residue (original residue number in PDB): T4 A5 Y6 S7 Q8 T10 R11 C16 T19 S20 D30 G31 E32 V33 Q34 V35 L36 S37 K62 T63 M94
• Binding residue (residue number reindexed from 1): T2 A3 Y4 S5 Q6 T8 R9 C14 T17 S18 D28 G29 E30 V31 Q32 V33 L34 S35 K60 T61 M92

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D81 G137 S139
• Catalytic site (residue number reindexed from 1): H55 D79 G135 S137
• Enzyme Commision number: 2.7.7.48: RNA-directed RNA polymerase.
  3.4.21.98: hepacivirin.
  3.4.22.-
  3.6.1.15: nucleoside-triphosphate phosphatase.
  3.6.4.13: RNA helicase.

Gene Ontology

Molecular Function

• GO:0008236 serine-type peptidase activity

Biological Process

• GO:0006508 proteolysis
• GO:0019087 transformation of host cell by virus

External links

• PDB: RCSB:1w3c, PDBe:1w3c, PDBj:1w3c
• PDBsum: 1w3c
• PubMed: 15588076
• UniProt: P26662|POLG_HCVJA Genome polyprotein