Structure of PDB 1w0t Chain A Binding Site BS01

Receptor Information
>1w0t Chain A (length=52) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMK
KL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1w0t How the Human Telomeric Proteins Trf1 and Trf2 Recognize Telomeric DNA: A View from High-Resolution Crystal Structures
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R380 G401 N402 W403 S404 K421 R425
Binding residue
(residue number reindexed from 1)		R2 G23 N24 W25 S26 K43 R47
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1w0t, PDBe:1w0t, PDBj:1w0t
PDBsum1w0t
PubMed15608617
UniProtP54274|TERF1_HUMAN Telomeric repeat-binding factor 1 (Gene Name=TERF1)

[Back to BioLiP]