Structure of PDB 1vrk Chain A Binding Site BS01

Receptor Information
>1vrk Chain A (length=148) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQD
MINEVDADGNGTIDFPEFLNLMARKMKDTDSEEKLKEAFRVFDKDGNGFI
SAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYEEFVQVMMAK
Ligand information
>1vrk Chain B (length=20) Species: 9031 (Gallus gallus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RRKWQKTGHAVRAIGRLSSS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1vrk Analysis of the functional coupling between calmodulin's calcium binding and peptide recognition properties.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		E11 F12 E14 A15 F19 M51 E54 L71 M72 R74 K84 F92 M109 E114 M124 F141 V144 M145 A147 K148
Binding residue
(residue number reindexed from 1)		E11 F12 E14 A15 F19 M51 E54 L71 M72 R74 K84 F92 M109 E114 M124 F141 V144 M145 A147 K148
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 16:35:28 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '1vrk', asym_id = 'A', bs = 'BS01', title = 'Analysis of the functional coupling between calm...cium binding and peptide recognition properties. '
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='1vrk', asym_id='A', bs='BS01', title='Analysis of the functional coupling between calm...cium binding and peptide recognition properties. ')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0005509', uniprot = '', pdbid = '1vrk', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005509', uniprot='', pdbid='1vrk', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>