Structure of PDB 1vdn Chain A Binding Site BS01

Receptor Information

>1vdn Chain A (length=161) Species: 4932 (Saccharomyces cerevisiae)

SQVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFGYAGSPF
HRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANA
GPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSPSGATK
ARIVVAKSGEL

Ligand information

>1vdn Chain B (length=5)

AAPAt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1vdn Crystal Structure Of Yeast Cyclophilin A Complexed With ACE-Ala-Ala-Pro-Ala-7-Amino-4-Methylcoumarin
• Resolution: 1.6 Å
• Binding residue (original residue number in PDB): R53 I55 F58 A99 N100 F111 L120 H124
• Binding residue (residue number reindexed from 1): R52 I54 F57 A98 N99 F110 L119 H123

Enzymatic activity

• Catalytic site (original residue number in PDB): R53 F58 Q61 N100 F111 L120 H124
• Catalytic site (residue number reindexed from 1): R52 F57 Q60 N99 F110 L119 H123
• Enzyme Commision number: 5.2.1.8: peptidylprolyl isomerase.

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003755 peptidyl-prolyl cis-trans isomerase activity
• GO:0016018 cyclosporin A binding

Biological Process

• GO:0000413 protein peptidyl-prolyl isomerization
• GO:0006457 protein folding
• GO:0006974 DNA damage response
• GO:0009267 cellular response to starvation
• GO:0015031 protein transport
• GO:0030437 ascospore formation
• GO:0045835 negative regulation of meiotic nuclear division
• GO:0045836 positive regulation of meiotic nuclear division

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space
• GO:0034967 Set3 complex

External links

• PDB: RCSB:1vdn, PDBe:1vdn, PDBj:1vdn
• PDBsum: 1vdn
• UniProt: P14832|CYPH_YEAST Peptidyl-prolyl cis-trans isomerase (Gene Name=CPR1)