Structure of PDB 1uvq Chain A Binding Site BS01

Receptor Information
>1uvq Chain A (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYVDLERKETAWRWPEF
SKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSKSPVT
LGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSFLSKSDHSFFKI
SYLTFLPSADEIYDCKVEHWGLDQPLLKHWEP
Ligand information
>1uvq Chain C (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MNLPSTKVSWAAVGGGGSLV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1uvq Crystal Structure of Hla-Dq0602 that Protects Against Type 1 Diabetes and Confers Strong Susceptibility to Narcolepsy
Resolution1.8 Å
Binding residue
(original residue number in PDB)		C11 Y25 H27 G55 G56 F57 N65 V68 H71 N72 I75 K78 R79 N81 S82
Binding residue
(residue number reindexed from 1)		C10 Y24 H26 G54 G55 F56 N64 V67 H70 N71 I74 K77 R78 N80 S81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002250 adaptive immune response
GO:0002504 antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005768 endosome
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1uvq, PDBe:1uvq, PDBj:1uvq
PDBsum1uvq
PubMed14769912
UniProtE9PMV2

[Back to BioLiP]